| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
| Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins) automatically mapped to Pfam PF00731 |
| Protein automated matches [191111] (4 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [189166] (1 PDB entry) |
| Domain d3kuub_: 3kuu B: [179725] automated match to d1d7aa_ complexed with so4 |
PDB Entry: 3kuu (more details), 1.41 Å
SCOPe Domain Sequences for d3kuub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kuub_ c.23.8.1 (B:) automated matches {Yersinia pestis [TaxId: 632]}
gvkiaivmgsksdwatmqfaadvlttlnvpfhvevvsahrtpdrlfsfaeqaeanglhvi
iagnggaahlpgmlaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
anaallaaqilalhdtelagrlahwrqsqtddvldnpdpree
Timeline for d3kuub_: