Lineage for d3kupc_ (3kup C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785156Protein automated matches [191035] (3 species)
    not a true protein
  7. 2785157Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)
  8. 2785169Domain d3kupc_: 3kup C: [179722]
    automated match to d1dz1a_
    complexed with unx

Details for d3kupc_

PDB Entry: 3kup (more details), 1.77 Å

PDB Description: crystal structure of the cbx3 chromo shadow domain
PDB Compounds: (C:) Chromobox protein homolog 3

SCOPe Domain Sequences for d3kupc_:

Sequence, based on SEQRES records: (download)

>d3kupc_ b.34.13.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafyeer
l

Sequence, based on observed residues (ATOM records): (download)

>d3kupc_ b.34.13.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkprgfargldperiigatdgelmflmkwkdsdeadlvlakeanmkcpqiviafyeerl

SCOPe Domain Coordinates for d3kupc_:

Click to download the PDB-style file with coordinates for d3kupc_.
(The format of our PDB-style files is described here.)

Timeline for d3kupc_: