SCOPe 2.01: Domain d3kupb_: 3kup B:

Lineage for d3kupb_ (3kup B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (7 PDB entries)

8. Domain d3kupb_: 3kup B: [179721]
   automated match to d1dz1a_
   complexed with unx

Details for d3kupb_

PDB Entry: 3kup, 1.77 Å

PDB Description: crystal structure of the cbx3 chromo shadow domain

PDB Compounds: (B:) Chromobox protein homolog 3

SCOPe Domain Sequences for d3kupb_:

Sequence; same for both SEQRES and ATOM records:

>d3kupb_ b.34.13.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafyeer
lt

Timeline for d3kupb_:

• d3kupb_ is new in SCOPe 2.01-stable
  
• d3kupb_ appears in SCOPe 2.02
  
• d3kupb_ appears in the current release, SCOPe 2.08