SCOPe 2.05: Domain d2ezya_: 2ezy A:

Lineage for d2ezya_ (2ezy A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)
   contains one classic and one pseudo HhH motifs
   automatically mapped to Pfam PF02961

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries)

8. Domain d2ezya_: 2ezy A: [17972]

Details for d2ezya_

PDB Entry: 2ezy

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures

PDB Compounds: (A:) barrier-to-autointegration factor

SCOPe Domain Sequences for d2ezya_:

Sequence; same for both SEQRES and ATOM records:

>d2ezya_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d2ezya_:

• d2ezya_ first appeared (with stable ids) in SCOP 1.55
  
• d2ezya_ appears in SCOPe 2.04
  
• d2ezya_ appears in SCOPe 2.06
  
• d2ezya_ appears in the current release, SCOPe 2.08