Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) contains one classic and one pseudo HhH motifs automatically mapped to Pfam PF02961 |
Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein) |
Protein Barrier-to-autointegration factor, BAF [47800] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries) |
Domain d2ezya_: 2ezy A: [17972] |
PDB Entry: 2ezy (more details)
SCOPe Domain Sequences for d2ezya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezya_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]} mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr ewlkdtcganakqsrdcfgclrewcdafl
Timeline for d2ezya_: