Lineage for d2ezya_ (2ezy A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98647Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
  5. 98648Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)
  6. 98649Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 98650Species Human (Homo sapiens) [TaxId:9606] [47801] (5 PDB entries)
  8. 98653Domain d2ezya_: 2ezy A: [17972]

Details for d2ezya_

PDB Entry: 2ezy (more details)

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures

SCOP Domain Sequences for d2ezya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezya_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens)}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

SCOP Domain Coordinates for d2ezya_:

Click to download the PDB-style file with coordinates for d2ezya_.
(The format of our PDB-style files is described here.)

Timeline for d2ezya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezyb_