Lineage for d3kuna_ (3kun A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686003Protein Dehaloperoxidase [46530] (1 species)
  7. 2686004Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)
  8. 2686013Domain d3kuna_: 3kun A: [179716]
    automated match to d1ew6a_
    complexed with cyn, hem, so4

Details for d3kuna_

PDB Entry: 3kun (more details), 1.26 Å

PDB Description: X-ray structure of the metcyano form of dehaloperoxidase from amphitrite ornata: evidence for photoreductive lysis of iron-cyanide bond
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3kuna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kuna_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3kuna_:

Click to download the PDB-style file with coordinates for d3kuna_.
(The format of our PDB-style files is described here.)

Timeline for d3kuna_: