Lineage for d3kucb_ (3kuc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932904Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2932911Protein c-Raf1 RBD [54264] (2 species)
  7. 2932912Species Human (Homo sapiens) [TaxId:9606] [54265] (8 PDB entries)
  8. 2932915Domain d3kucb_: 3kuc B: [179710]
    Other proteins in same PDB: d3kuca_
    automated match to d1c1yb_
    complexed with ca, gdp, mg

Details for d3kucb_

PDB Entry: 3kuc (more details), 1.92 Å

PDB Description: complex of rap1a(e30d/k31e)gdp with rafrbd(a85k/n71r)
PDB Compounds: (B:) raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d3kucb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kucb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]}
ntirvflpnkqrtvvrvrngmslhdclmkklkvrglqpeccavfrllhehkgkkarldwn
tdaasligeelqvdfl

SCOPe Domain Coordinates for d3kucb_:

Click to download the PDB-style file with coordinates for d3kucb_.
(The format of our PDB-style files is described here.)

Timeline for d3kucb_:

2932915
d3kucb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3kuca_