Lineage for d1ci4b_ (1ci4 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.60: SAM domain-like [47768] (10 superfamilies) Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) 
Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein) Protein Barrier-to-autointegration factor, BAF [47800] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47801] (5 PDB entries) 
Domain d1ci4b_: 1ci4 B: [17971]
Details for d1ci4b_
PDB Entry: 1ci4 (more details), 1.9 Å
PDB Description: the crystal structure of human barrier-to-autointegration factor (baf)
SCOP Domain Sequences for d1ci4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci4b_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens)}
ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
wlkdtcganakqsrdcfgclrewcdafl
SCOP Domain Coordinates for d1ci4b_:
Click to download the PDB-style file with coordinates for d1ci4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ci4b_:
- d1ci4b_ appears in SCOP 1.57
- d1ci4b_ appears in the current release, SCOPe 2.08
View in 3D
