Lineage for d3ku5a_ (3ku5 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942760Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 942761Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 942806Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 942807Protein Hemagglutinin [49824] (5 species)
    includes rudiment esterase domain
  7. 942813Species Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries)
  8. 942815Domain d3ku5a_: 3ku5 A: [179703]
    automated match to d1jsma_
    complexed with edo, nag, peg

Details for d3ku5a_

PDB Entry: 3ku5 (more details), 1.73 Å

PDB Description: crystal structure of a h2n2 influenza virus hemagglutinin, human like
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3ku5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ku5a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdti
nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
gecpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d3ku5a_:

Click to download the PDB-style file with coordinates for d3ku5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ku5a_: