Lineage for d3ktoc_ (3kto C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158378Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1158379Protein automated matches [190131] (17 species)
    not a true protein
  7. 1158416Species Pseudoalteromonas atlantica [TaxId:342610] [189165] (1 PDB entry)
  8. 1158419Domain d3ktoc_: 3kto C: [179697]
    automated match to d1d5wb_

Details for d3ktoc_

PDB Entry: 3kto (more details), 1.98 Å

PDB Description: crystal structure of response regulator receiver protein from pseudoalteromonas atlantica
PDB Compounds: (C:) Response regulator receiver protein

SCOPe Domain Sequences for d3ktoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktoc_ c.23.1.0 (C:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}
piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing

SCOPe Domain Coordinates for d3ktoc_:

Click to download the PDB-style file with coordinates for d3ktoc_.
(The format of our PDB-style files is described here.)

Timeline for d3ktoc_: