SCOPe 2.02: Domain d3ktob_: 3kto B:

Lineage for d3ktob_ (3kto B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (17 species)
   not a true protein

7. Species Pseudoalteromonas atlantica [TaxId:342610] [189165] (1 PDB entry)

8. Domain d3ktob_: 3kto B: [179696]
   automated match to d1d5wb_

Details for d3ktob_

PDB Entry: 3kto, 1.98 Å

PDB Description: crystal structure of response regulator receiver protein from pseudoalteromonas atlantica

PDB Compounds: (B:) Response regulator receiver protein

SCOPe Domain Sequences for d3ktob_:

Sequence; same for both SEQRES and ATOM records:

>d3ktob_ c.23.1.0 (B:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}
piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing
ak

Timeline for d3ktob_:

• d3ktob_ first appeared in SCOPe 2.01
  
• d3ktob_ appears in SCOPe 2.03
  
• d3ktob_ appears in the current release, SCOPe 2.08