Lineage for d3ktoa_ (3kto A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982514Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 982515Protein automated matches [190131] (16 species)
    not a true protein
  7. 982549Species Pseudoalteromonas atlantica [TaxId:342610] [189165] (1 PDB entry)
  8. 982550Domain d3ktoa_: 3kto A: [179695]
    automated match to d1d5wb_

Details for d3ktoa_

PDB Entry: 3kto (more details), 1.98 Å

PDB Description: crystal structure of response regulator receiver protein from pseudoalteromonas atlantica
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d3ktoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktoa_ c.23.1.0 (A:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}
piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing
ak

SCOPe Domain Coordinates for d3ktoa_:

Click to download the PDB-style file with coordinates for d3ktoa_.
(The format of our PDB-style files is described here.)

Timeline for d3ktoa_: