Lineage for d1b22a_ (1b22 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539425Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 539426Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 539427Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)
  7. 539440Species Human (Homo sapiens) [TaxId:9606] [47797] (1 PDB entry)
  8. 539441Domain d1b22a_: 1b22 A: [17969]

Details for d1b22a_

PDB Entry: 1b22 (more details)

PDB Description: rad51 (n-terminal domain)

SCOP Domain Sequences for d1b22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens)}
eeesfgpqpisrleqcginandvkkleeagfhtveavayapkkelinikgiseakadkil
aeaaklvpmg

SCOP Domain Coordinates for d1b22a_:

Click to download the PDB-style file with coordinates for d1b22a_.
(The format of our PDB-style files is described here.)

Timeline for d1b22a_: