![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein automated matches [190149] (7 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [189283] (4 PDB entries) |
![]() | Domain d3ktki_: 3ktk I: [179689] automated match to d1tyfa_ |
PDB Entry: 3ktk (more details), 2.6 Å
SCOPe Domain Sequences for d3ktki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ktki_ c.14.1.1 (I:) automated matches {Bacillus subtilis [TaxId: 1423]} diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
Timeline for d3ktki_: