| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
| Protein automated matches [190149] (14 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [189283] (5 PDB entries) |
| Domain d3ktkh_: 3ktk H: [179688] automated match to d1tyfa_ |
PDB Entry: 3ktk (more details), 2.6 Å
SCOPe Domain Sequences for d3ktkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ktkh_ c.14.1.1 (H:) automated matches {Bacillus subtilis [TaxId: 1423]}
diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
Timeline for d3ktkh_: