Lineage for d3ktkb_ (3ktk B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835241Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 1835406Protein automated matches [190149] (9 species)
    not a true protein
  7. 1835407Species Bacillus subtilis [TaxId:1423] [189283] (5 PDB entries)
  8. 1835430Domain d3ktkb_: 3ktk B: [179682]
    automated match to d1tyfa_

Details for d3ktkb_

PDB Entry: 3ktk (more details), 2.6 Å

PDB Description: Structure of ClpP in complex with ADEP2 in triclinic crystal form
PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3ktkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktkb_ c.14.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth

SCOPe Domain Coordinates for d3ktkb_:

Click to download the PDB-style file with coordinates for d3ktkb_.
(The format of our PDB-style files is described here.)

Timeline for d3ktkb_: