Lineage for d3ktjf_ (3ktj F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852609Species Bacillus subtilis [TaxId:1423] [189283] (5 PDB entries)
  8. 2852629Domain d3ktjf_: 3ktj F: [179679]
    automated match to d1tyfa_
    complexed with nhe

Details for d3ktjf_

PDB Entry: 3ktj (more details), 2.6 Å

PDB Description: Structure of ClpP in complex with ADEP2 in monoclinic crystal form
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3ktjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktjf_ c.14.1.1 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth

SCOPe Domain Coordinates for d3ktjf_:

Click to download the PDB-style file with coordinates for d3ktjf_.
(The format of our PDB-style files is described here.)

Timeline for d3ktjf_: