Lineage for d3ktie_ (3kti E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980845Protein automated matches [190149] (5 species)
    not a true protein
  7. 980846Species Bacillus subtilis [TaxId:1423] [189283] (4 PDB entries)
  8. 980851Domain d3ktie_: 3kti E: [179671]
    automated match to d1tyfa_
    complexed with dms, nhe

Details for d3ktie_

PDB Entry: 3kti (more details), 2 Å

PDB Description: Structure of ClpP in complex with ADEP1
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3ktie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktie_ c.14.1.1 (E:) automated matches {Bacillus subtilis [TaxId: 1423]}
diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth

SCOPe Domain Coordinates for d3ktie_:

Click to download the PDB-style file with coordinates for d3ktie_.
(The format of our PDB-style files is described here.)

Timeline for d3ktie_: