Lineage for d1coo__ (1coo -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98635Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
  5. 98636Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (1 protein)
  6. 98637Protein C-terminal domain of RNA polymerase alpha subunit [47791] (2 species)
  7. 98638Species Escherichia coli [TaxId:562] [47792] (1 PDB entry)
  8. 98639Domain d1coo__: 1coo - [17967]

Details for d1coo__

PDB Entry: 1coo (more details)

PDB Description: the cooh-terminal domain of rna polymerase alpha subunit

SCOP Domain Sequences for d1coo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1coo__ a.60.3.1 (-) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade

SCOP Domain Coordinates for d1coo__:

Click to download the PDB-style file with coordinates for d1coo__.
(The format of our PDB-style files is described here.)

Timeline for d1coo__: