| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) |
| Protein automated matches [190149] (5 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [189283] (4 PDB entries) |
| Domain d3ktib_: 3kti B: [179668] automated match to d1tyfa_ complexed with dms, nhe |
PDB Entry: 3kti (more details), 2 Å
SCOPe Domain Sequences for d3ktib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ktib_ c.14.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth
Timeline for d3ktib_: