Lineage for d3ktgc1 (3ktg C:3-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852609Species Bacillus subtilis [TaxId:1423] [189283] (5 PDB entries)
  8. 2852619Domain d3ktgc1: 3ktg C:3-196 [179662]
    Other proteins in same PDB: d3ktga2, d3ktgb2, d3ktgc2, d3ktgd2, d3ktge2, d3ktgf2, d3ktgg2
    automated match to d1tyfa_

Details for d3ktgc1

PDB Entry: 3ktg (more details), 2.4 Å

PDB Description: structure of clpp from bacillus subtilis in monoclinic crystal form
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3ktgc1:

Sequence, based on SEQRES records: (download)

>d3ktgc1 c.14.1.1 (C:3-196) automated matches {Bacillus subtilis [TaxId: 1423]}
iptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeisly
inspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmih
qplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealey
glidkilthlehhh

Sequence, based on observed residues (ATOM records): (download)

>d3ktgc1 c.14.1.1 (C:3-196) automated matches {Bacillus subtilis [TaxId: 1423]}
iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
hlehhh

SCOPe Domain Coordinates for d3ktgc1:

Click to download the PDB-style file with coordinates for d3ktgc1.
(The format of our PDB-style files is described here.)

Timeline for d3ktgc1: