SCOPe 2.08: Domain d3ktgb1: 3ktg B:3-196

Lineage for d3ktgb1 (3ktg B:3-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
   automatically mapped to Pfam PF00574

6. Protein automated matches [190149] (14 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189283] (5 PDB entries)

8. Domain d3ktgb1: 3ktg B:3-196 [179661]
   Other proteins in same PDB: d3ktga2, d3ktgb2, d3ktgc2, d3ktgd2, d3ktge2, d3ktgf2, d3ktgg2
   automated match to d1tyfa_

Details for d3ktgb1

PDB Entry: 3ktg, 2.4 Å

PDB Description: structure of clpp from bacillus subtilis in monoclinic crystal form

PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3ktgb1:

Sequence, based on SEQRES records:

>d3ktgb1 c.14.1.1 (B:3-196) automated matches {Bacillus subtilis [TaxId: 1423]}
iptvieqtnrgeraydiysrllkdriimlgsaiddnvansivsqllflaaedpekeisly
inspggsitagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmih
qplggaqgqateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealey
glidkilthlehhh

Sequence, based on observed residues (ATOM records):

>d3ktgb1 c.14.1.1 (B:3-196) automated matches {Bacillus subtilis [TaxId: 1423]}
iptviaydiysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsi
tagmaiydtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqg
qateieiaakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilt
hlehhh

Timeline for d3ktgb1:

• d3ktgb1 first appeared in SCOPe 2.01, called d3ktgb_
  
• d3ktgb1 appears in SCOPe 2.07