Class b: All beta proteins [48724] (180 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
Protein automated matches [191125] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries) |
Domain d3kt9a_: 3kt9 A: [179659] automated match to d1yj5c1 |
PDB Entry: 3kt9 (more details), 1.65 Å
SCOPe Domain Sequences for d3kt9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kt9a_ b.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mmrvcwlvrqdsrhqrirlphleavvigrgpetkitdkkcsrqqvqlkaecnkgyvkvkq vgvnptsidsvvigkdqevklqpgqvlhmvnelypyivefee
Timeline for d3kt9a_: