Lineage for d3kt9a_ (3kt9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778225Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries)
  8. 2778226Domain d3kt9a_: 3kt9 A: [179659]
    automated match to d1yj5c1

Details for d3kt9a_

PDB Entry: 3kt9 (more details), 1.65 Å

PDB Description: aprataxin fha domain
PDB Compounds: (A:) Aprataxin

SCOPe Domain Sequences for d3kt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kt9a_ b.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmrvcwlvrqdsrhqrirlphleavvigrgpetkitdkkcsrqqvqlkaecnkgyvkvkq
vgvnptsidsvvigkdqevklqpgqvlhmvnelypyivefee

SCOPe Domain Coordinates for d3kt9a_:

Click to download the PDB-style file with coordinates for d3kt9a_.
(The format of our PDB-style files is described here.)

Timeline for d3kt9a_: