SCOPe 2.05: Domain d3ksva_: 3ksv A:

Lineage for d3ksva_ (3ksv A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.0: automated matches [191614] (1 protein)
   not a true family

6. Protein automated matches [191122] (9 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [189192] (1 PDB entry)

8. Domain d3ksva_: 3ksv A: [179658]
   automated match to d1y23a_
   complexed with zn

Details for d3ksva_

PDB Entry: 3ksv, 1.9 Å

PDB Description: hypothetical protein from leishmania major

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3ksva_:

Sequence; same for both SEQRES and ATOM records:

>d3ksva_ d.13.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
maancifckiikgdipcakvaetskalafmdinplsrghmlvipkehasclhelgmedaa
dvgvllakasravagpdgsmqynvlqnngslahqevphvhfhiipktdektglkigwdtv
kvasdelaedakryseaiaki

Timeline for d3ksva_:

• d3ksva_ first appeared in SCOPe 2.01
  
• d3ksva_ appears in SCOPe 2.04
  
• d3ksva_ appears in SCOPe 2.06
  
• d3ksva_ appears in the current release, SCOPe 2.08