Lineage for d3ksva_ (3ksv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930032Species Leishmania major [TaxId:5664] [189192] (1 PDB entry)
  8. 2930033Domain d3ksva_: 3ksv A: [179658]
    automated match to d1y23a_
    complexed with zn

Details for d3ksva_

PDB Entry: 3ksv (more details), 1.9 Å

PDB Description: hypothetical protein from leishmania major
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3ksva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ksva_ d.13.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
maancifckiikgdipcakvaetskalafmdinplsrghmlvipkehasclhelgmedaa
dvgvllakasravagpdgsmqynvlqnngslahqevphvhfhiipktdektglkigwdtv
kvasdelaedakryseaiaki

SCOPe Domain Coordinates for d3ksva_:

Click to download the PDB-style file with coordinates for d3ksva_.
(The format of our PDB-style files is described here.)

Timeline for d3ksva_: