![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
![]() | Protein automated matches [191122] (10 species) not a true protein |
![]() | Species Leishmania major [TaxId:5664] [189192] (1 PDB entry) |
![]() | Domain d3ksva_: 3ksv A: [179658] automated match to d1y23a_ complexed with zn |
PDB Entry: 3ksv (more details), 1.9 Å
SCOPe Domain Sequences for d3ksva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ksva_ d.13.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]} maancifckiikgdipcakvaetskalafmdinplsrghmlvipkehasclhelgmedaa dvgvllakasravagpdgsmqynvlqnngslahqevphvhfhiipktdektglkigwdtv kvasdelaedakryseaiaki
Timeline for d3ksva_: