Lineage for d3ksfb_ (3ksf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970295Species Staphylococcus aureus [TaxId:282458] [189340] (4 PDB entries)
  8. 2970299Domain d3ksfb_: 3ksf B: [179646]
    automated match to d1vhma_
    complexed with peg

Details for d3ksfb_

PDB Entry: 3ksf (more details), 1.9 Å

PDB Description: structure of fRMsr of Staphylococcus aureus (reduced form)
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ksfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ksfb_ d.110.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
tinptnytllkkqaasliedehhmiailsnmsallndnldqinwvgfylleqnelilgpf
qghpacvhipigkgvcgtavserrtqvvadvhqfkghiacdanskseivvpifkddkiig
vldidapitdrfddndkehleaivkiiekqla

SCOPe Domain Coordinates for d3ksfb_:

Click to download the PDB-style file with coordinates for d3ksfb_.
(The format of our PDB-style files is described here.)

Timeline for d3ksfb_: