Lineage for d3ksed_ (3kse D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935752Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2935758Protein Cystatin A (stefin A) [54412] (1 species)
  7. 2935759Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)
  8. 2935760Domain d3ksed_: 3kse D: [179642]
    automated match to d1dvca_

Details for d3ksed_

PDB Entry: 3kse (more details), 1.71 Å

PDB Description: Unreduced cathepsin L in complex with stefin A
PDB Compounds: (D:) Cystatin-A

SCOPe Domain Sequences for d3ksed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ksed_ d.17.1.2 (D:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

SCOPe Domain Coordinates for d3ksed_:

Click to download the PDB-style file with coordinates for d3ksed_.
(The format of our PDB-style files is described here.)

Timeline for d3ksed_: