Lineage for d3ks9a_ (3ks9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143939Protein automated matches [190296] (11 species)
    not a true protein
  7. 2143963Species Human (Homo sapiens) [TaxId:9606] [189164] (3 PDB entries)
  8. 2143965Domain d3ks9a_: 3ks9 A: [179640]
    automated match to d1ewkb_
    complexed with mg, nag, z99

Details for d3ks9a_

PDB Entry: 3ks9 (more details), 1.9 Å

PDB Description: metabotropic glutamate receptor mglur1 complexed with ly341495 antagonist
PDB Compounds: (A:) Metabotropic glutamate receptor 1

SCOPe Domain Sequences for d3ks9a_:

Sequence, based on SEQRES records: (download)

>d3ks9a_ c.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpv
llpnitlgseirdscwhssvaleqsiefirdslisirdekdginrclpdgqslppgrtkk
piagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqara
mldivkrynwtyvsavhtegnygesgmdafkelaaqeglsiahsdkiysnageksfdrll
rklrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyevea
nggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkric
tgnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgsklldfl
ikssfigvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki

Sequence, based on observed residues (ATOM records): (download)

>d3ks9a_ c.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpv
llpnitlgseirdscwhssvaleqsiefirdslkpiagvigpgsssvaiqvqnllqlfdi
pqiaysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesg
mdafkelaaqeglsiahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgll
samrrlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrld
tntrnpwfpefwqhrfqcrlpgpnfkrictgnesleenyvqdskmgfvinaiyamahglq
nmhhalcpghvglcdamkpidgsklldflikssfigvsgeevwfdekgdapgrydimnlq
yterydyvhvgtwhegvlniddyki

SCOPe Domain Coordinates for d3ks9a_:

Click to download the PDB-style file with coordinates for d3ks9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ks9a_: