Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein) |
Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species) duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain |
Species Thermus filiformis [TaxId:276] [47788] (2 PDB entries) |
Domain d1dgsb1: 1dgs B:2401-2581 [17964] Other proteins in same PDB: d1dgsa2, d1dgsa3, d1dgsb2, d1dgsb3 protein/DNA complex; complexed with amp, zn |
PDB Entry: 1dgs (more details), 2.9 Å
SCOPe Domain Sequences for d1dgsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgsb1 a.60.2.2 (B:2401-2581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} rwpeacpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla rnlarrfgtmdrlleasleelieveevgeltarailetlkdpafrdlvrrlkeagvsmes k
Timeline for d1dgsb1: