Lineage for d1dgsb1 (1dgs B:2401-2581)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356835Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 356860Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein)
  6. 356861Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species)
    duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain
  7. 356862Species Thermus filiformis [TaxId:276] [47788] (2 PDB entries)
  8. 356864Domain d1dgsb1: 1dgs B:2401-2581 [17964]
    Other proteins in same PDB: d1dgsa2, d1dgsa3, d1dgsb2, d1dgsb3
    complexed with amp, zn

Details for d1dgsb1

PDB Entry: 1dgs (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase from t. filiformis

SCOP Domain Sequences for d1dgsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgsb1 a.60.2.2 (B:2401-2581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis}
rwpeacpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek
glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla
rnlarrfgtmdrlleasleelieveevgeltarailetlkdpafrdlvrrlkeagvsmes
k

SCOP Domain Coordinates for d1dgsb1:

Click to download the PDB-style file with coordinates for d1dgsb1.
(The format of our PDB-style files is described here.)

Timeline for d1dgsb1: