Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (11 species) not a true protein |
Species Thermoanaerobacter pseudethanolicus [TaxId:340099] [189163] (2 PDB entries) |
Domain d3krzd_: 3krz D: [179638] automated match to d1z41a1 complexed with fmn, txd |
PDB Entry: 3krz (more details), 1.8 Å
SCOPe Domain Sequences for d3krzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3krzd_ c.1.4.0 (D:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]} silhmplkikditiknrimmspmcmysastdgmpndwhivhyatraiggvglimqeatav esrgritdhdlgiwndeqvkelkkivdickangavmgiqlahagrkcnisyedvvgpspi kagdryklprelsveeiksivkafgeaakranlagydvveihaahgyliheflsplsnkr kdeygnsienrarflievidevrknwpenkpifvrvsaddymegginidmmveyinmikd kvdlidvssggllnvdinlypgyqvkyaetikkrcniktsavglittqelaeeilsnera dlvalgrellrnpywvlhtytskedwpkqyerafk
Timeline for d3krzd_: