SCOPe 2.01: Domain d3krzd_: 3krz D:

Lineage for d3krzd_ (3krz D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (11 species)
   not a true protein

7. Species Thermoanaerobacter pseudethanolicus [TaxId:340099] [189163] (2 PDB entries)

8. Domain d3krzd_: 3krz D: [179638]
   automated match to d1z41a1
   complexed with fmn, txd

Details for d3krzd_

PDB Entry: 3krz, 1.8 Å

PDB Description: Crystal Structure of the Thermostable NADH4-bound old yellow enzyme from Thermoanaerobacter pseudethanolicus E39

PDB Compounds: (D:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d3krzd_:

Sequence; same for both SEQRES and ATOM records:

>d3krzd_ c.1.4.0 (D:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]}
silhmplkikditiknrimmspmcmysastdgmpndwhivhyatraiggvglimqeatav
esrgritdhdlgiwndeqvkelkkivdickangavmgiqlahagrkcnisyedvvgpspi
kagdryklprelsveeiksivkafgeaakranlagydvveihaahgyliheflsplsnkr
kdeygnsienrarflievidevrknwpenkpifvrvsaddymegginidmmveyinmikd
kvdlidvssggllnvdinlypgyqvkyaetikkrcniktsavglittqelaeeilsnera
dlvalgrellrnpywvlhtytskedwpkqyerafk

Timeline for d3krzd_:

• d3krzd_ is new in SCOPe 2.01-stable
  
• d3krzd_ appears in SCOPe 2.02
  
• d3krzd_ appears in the current release, SCOPe 2.08