Lineage for d3krwg_ (3krw G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346824Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2346825Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2346826Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2346827Species Cow (Bos taurus) [TaxId:9913] [48673] (56 PDB entries)
  8. 2346848Domain d3krwg_: 3krw G: [179631]
    Other proteins in same PDB: d3krwa1, d3krwa2, d3krwa3, d3krwb_
    automated match to d1omwg_
    complexed with ba1, mg

Details for d3krwg_

PDB Entry: 3krw (more details), 2.9 Å

PDB Description: Human GRK2 in complex with Gbetgamma subunits and balanol (soak)
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3krwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krwg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

SCOPe Domain Coordinates for d3krwg_:

Click to download the PDB-style file with coordinates for d3krwg_.
(The format of our PDB-style files is described here.)

Timeline for d3krwg_: