Lineage for d3krvb_ (3krv B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110823Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2111323Superfamily c.8.8: Putative cyclase [102198] (2 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 2111324Family c.8.8.1: Putative cyclase [102199] (2 proteins)
    Pfam PF04199; COG1878: predicted metal-dependent hydrolase
  6. 2111328Protein Unnamed protein [102200] (1 species)
    not in the sequence database yet; closest homologue is TTE1006 from Thermoanaerobacter tengcongensis
  7. 2111329Species Bacillus stearothermophilus [TaxId:1422] [102201] (2 PDB entries)
    conflict: annotated in PDB as from Escherichia coli
  8. 2111333Domain d3krvb_: 3krv B: [179629]
    automated match to d1r61a_
    complexed with cl, edo, gol, so4, zn

Details for d3krvb_

PDB Entry: 3krv (more details), 2.55 Å

PDB Description: The Structure Of Potential Metal-Dependent Hydrolase With Cyclase Activity
PDB Compounds: (B:) hydrolase

SCOPe Domain Sequences for d3krvb_:

Sequence, based on SEQRES records: (download)

>d3krvb_ c.8.8.1 (B:) Unnamed protein {Bacillus stearothermophilus [TaxId: 1422]}
amkvydvtapiyegmpvyknkpekqpkrttitngyvtesridmdvhtgthidaplhmveg
gatfetiplndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfef
ifvaedaaryladkqirgvgidalgieraqeghpthktlfsagviiieglrlkdvpegry
fmvaaplklvgtdaaparvllfdrep

Sequence, based on observed residues (ATOM records): (download)

>d3krvb_ c.8.8.1 (B:) Unnamed protein {Bacillus stearothermophilus [TaxId: 1422]}
amkvydvtapiyegmpvyknkpekqpkrttitesridmdvhtgthidaplhmveggatfe
tiplndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfefifvae
daaryladkqirgvgidalgieraqeghpthktlfsagviiieglrlkdvpegryfmvaa
plklvgtdaaparvllfdrep

SCOPe Domain Coordinates for d3krvb_:

Click to download the PDB-style file with coordinates for d3krvb_.
(The format of our PDB-style files is described here.)

Timeline for d3krvb_: