Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.8: Putative cyclase [102198] (2 families) contains mixed beta-sheet barrel, closed n=7, S=10 |
Family c.8.8.1: Putative cyclase [102199] (2 proteins) Pfam PF04199; COG1878: predicted metal-dependent hydrolase |
Protein Unnamed protein [102200] (1 species) not in the sequence database yet; closest homologue is TTE1006 from Thermoanaerobacter tengcongensis |
Species Bacillus stearothermophilus [TaxId:1422] [102201] (2 PDB entries) conflict: annotated in PDB as from Escherichia coli |
Domain d3krva_: 3krv A: [179628] automated match to d1r61a_ complexed with cl, edo, gol, so4, zn |
PDB Entry: 3krv (more details), 2.55 Å
SCOPe Domain Sequences for d3krva_:
Sequence, based on SEQRES records: (download)
>d3krva_ c.8.8.1 (A:) Unnamed protein {Bacillus stearothermophilus [TaxId: 1422]} amkvydvtapiyegmpvyknkpekqpkrttitngyvtesridmdvhtgthidaplhmveg gatfetiplndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfef ifvaedaaryladkqirgvgidalgieraqeghpthktlfsagviiieglrlkdvpegry fmvaaplklvgtdaaparvllfdr
>d3krva_ c.8.8.1 (A:) Unnamed protein {Bacillus stearothermophilus [TaxId: 1422]} amkvydvtapiyegmpvyknkpekqpkrttitngyvtesridmdvhtgthidaplhmvet fetiplndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfefifv aedaaryladkqirgvgidalgieraqeghpthktlfsagviiieglrlkdvpegryfmv aaplklvgtdaaparvllfdr
Timeline for d3krva_: