SCOPe 2.08: Domain d3krva_: 3krv A:

Lineage for d3krva_ (3krv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.8: Putative cyclase [102198] (2 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.8.1: Putative cyclase [102199] (2 proteins)
   Pfam PF04199; COG1878: predicted metal-dependent hydrolase

6. Protein Unnamed protein [102200] (1 species)
   not in the sequence database yet; closest homologue is TTE1006 from Thermoanaerobacter tengcongensis

7. Species Bacillus stearothermophilus [TaxId:1422] [102201] (2 PDB entries)
   conflict: annotated in PDB as from Escherichia coli

8. Domain d3krva_: 3krv A: [179628]
   automated match to d1r61a_
   complexed with cl, edo, gol, so4, zn

Details for d3krva_

PDB Entry: 3krv, 2.55 Å

PDB Description: The Structure Of Potential Metal-Dependent Hydrolase With Cyclase Activity

PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d3krva_:

Sequence, based on SEQRES records:

>d3krva_ c.8.8.1 (A:) Unnamed protein {Bacillus stearothermophilus [TaxId: 1422]}
amkvydvtapiyegmpvyknkpekqpkrttitngyvtesridmdvhtgthidaplhmveg
gatfetiplndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfef
ifvaedaaryladkqirgvgidalgieraqeghpthktlfsagviiieglrlkdvpegry
fmvaaplklvgtdaaparvllfdr

Sequence, based on observed residues (ATOM records):

>d3krva_ c.8.8.1 (A:) Unnamed protein {Bacillus stearothermophilus [TaxId: 1422]}
amkvydvtapiyegmpvyknkpekqpkrttitngyvtesridmdvhtgthidaplhmvet
fetiplndlvgpcklfdlthvndritkddiahldiqegdfvlfktknsfedafhfefifv
aedaaryladkqirgvgidalgieraqeghpthktlfsagviiieglrlkdvpegryfmv
aaplklvgtdaaparvllfdr

Timeline for d3krva_:

• d3krva_ first appeared in SCOPe 2.01
  
• d3krva_ appears in SCOPe 2.07