Lineage for d3krud_ (3kru D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1817199Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 1817200Protein automated matches [190048] (17 species)
    not a true protein
  7. 1817306Species Thermoanaerobacter pseudethanolicus [TaxId:340099] [189163] (2 PDB entries)
  8. 1817310Domain d3krud_: 3kru D: [179627]
    automated match to d1z41a1
    complexed with act, fmn

Details for d3krud_

PDB Entry: 3kru (more details), 1.6 Å

PDB Description: Crystal Structure of the Thermostable Old Yellow Enzyme from Thermoanaerobacter pseudethanolicus E39
PDB Compounds: (D:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d3krud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krud_ c.1.4.0 (D:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]}
silhmplkikditiknrimmspmcmysastdgmpndwhivhyatraiggvglimqeatav
esrgritdhdlgiwndeqvkelkkivdickangavmgiqlahagrkcnisyedvvgpspi
kagdryklprelsveeiksivkafgeaakranlagydvveihaahgyliheflsplsnkr
kdeygnsienrarflievidevrknwpenkpifvrvsaddymegginidmmveyinmikd
kvdlidvssggllnvdinlypgyqvkyaetikkrcniktsavglittqelaeeilsnera
dlvalgrellrnpywvlhtytskedwpkqyerafk

SCOPe Domain Coordinates for d3krud_:

Click to download the PDB-style file with coordinates for d3krud_.
(The format of our PDB-style files is described here.)

Timeline for d3krud_: