Lineage for d3kruc_ (3kru C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080617Species Thermoanaerobacter pseudethanolicus [TaxId:340099] [189163] (2 PDB entries)
  8. 2080620Domain d3kruc_: 3kru C: [179626]
    automated match to d1z41a1
    complexed with act, fmn

Details for d3kruc_

PDB Entry: 3kru (more details), 1.6 Å

PDB Description: Crystal Structure of the Thermostable Old Yellow Enzyme from Thermoanaerobacter pseudethanolicus E39
PDB Compounds: (C:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d3kruc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kruc_ c.1.4.0 (C:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]}
silhmplkikditiknrimmspmcmysastdgmpndwhivhyatraiggvglimqeatav
esrgritdhdlgiwndeqvkelkkivdickangavmgiqlahagrkcnisyedvvgpspi
kagdryklprelsveeiksivkafgeaakranlagydvveihaahgyliheflsplsnkr
kdeygnsienrarflievidevrknwpenkpifvrvsaddymegginidmmveyinmikd
kvdlidvssggllnvdinlypgyqvkyaetikkrcniktsavglittqelaeeilsnera
dlvalgrellrnpywvlhtytskedwpkqyeraf

SCOPe Domain Coordinates for d3kruc_:

Click to download the PDB-style file with coordinates for d3kruc_.
(The format of our PDB-style files is described here.)

Timeline for d3kruc_: