Lineage for d3krga_ (3krg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813494Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 2813530Protein automated matches [190887] (2 species)
    not a true protein
  7. 2813531Species Bacillus subtilis [TaxId:1423] [188279] (8 PDB entries)
  8. 2813536Domain d3krga_: 3krg A: [179620]
    automated match to d1bn8a_
    complexed with co, gol

Details for d3krga_

PDB Entry: 3krg (more details), 1.9 Å

PDB Description: structural insights into substrate specificity and the anti beta- elimination mechanism of pectate lyase
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d3krga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krga_ b.80.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptagssgnwa
sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
yyhdhdassifgssdsktsddgklkitlhhnryknivqraprvrfgqvhvynnyyegsts
sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
aanglsssvgwtpslhgsidasanvksnvinqagagkln

SCOPe Domain Coordinates for d3krga_:

Click to download the PDB-style file with coordinates for d3krga_.
(The format of our PDB-style files is described here.)

Timeline for d3krga_: