Lineage for d3kr3d_ (3kr3 D:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1959978Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1959979Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1959980Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1960228Protein automated matches [191064] (1 species)
    not a true protein
  7. 1960229Species Human (Homo sapiens) [TaxId:9606] [188960] (3 PDB entries)
  8. 1960230Domain d3kr3d_: 3kr3 D: [179590]
    Other proteins in same PDB: d3kr3l1, d3kr3l2
    automated match to d1igla_
    complexed with edo

Details for d3kr3d_

PDB Entry: 3kr3 (more details), 2.2 Å

PDB Description: Crystal structure of IGF-II antibody complex
PDB Compounds: (D:) insulin-like growth factor II

SCOPe Domain Sequences for d3kr3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kr3d_ g.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatpa

SCOPe Domain Coordinates for d3kr3d_:

Click to download the PDB-style file with coordinates for d3kr3d_.
(The format of our PDB-style files is described here.)

Timeline for d3kr3d_: