Class g: Small proteins [56992] (92 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein automated matches [191064] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188960] (3 PDB entries) |
Domain d3kr3d_: 3kr3 D: [179590] Other proteins in same PDB: d3kr3l1, d3kr3l2 automated match to d1igla_ complexed with edo |
PDB Entry: 3kr3 (more details), 2.2 Å
SCOPe Domain Sequences for d3kr3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kr3d_ g.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} setlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatpa
Timeline for d3kr3d_: