Lineage for d1bvse2 (1bvs E:64-134)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48676Superfamily a.60.2: RuvA domain 2-like [47781] (2 families) (S)
  5. 48677Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 48678Protein DNA helicase RuvA subunit, middle domain [47783] (2 species)
  7. 48689Species Mycobacterium leprae [TaxId:1769] [47785] (1 PDB entry)
  8. 48694Domain d1bvse2: 1bvs E:64-134 [17959]
    Other proteins in same PDB: d1bvsa1, d1bvsa3, d1bvsb1, d1bvsb3, d1bvsc1, d1bvsc3, d1bvsd1, d1bvsd3, d1bvse1, d1bvse3, d1bvsf1, d1bvsf3, d1bvsg1, d1bvsg3, d1bvsh1, d1bvsh3

Details for d1bvse2

PDB Entry: 1bvs (more details), 3 Å

PDB Description: ruva complexed to a holliday junction.

SCOP Domain Sequences for d1bvse2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvse2 a.60.2.1 (E:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae}
daenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrgaeri
vleladkvgpv

SCOP Domain Coordinates for d1bvse2:

Click to download the PDB-style file with coordinates for d1bvse2.
(The format of our PDB-style files is described here.)

Timeline for d1bvse2: