| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
| Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
| Protein automated matches [190168] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries) |
| Domain d3kr1a_: 3kr1 A: [179586] Other proteins in same PDB: d3kr1b2 automated match to d1hnnb_ complexed with sah, vgd |
PDB Entry: 3kr1 (more details), 2.3 Å
SCOPe Domain Sequences for d3kr1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kr1a_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv
Timeline for d3kr1a_: