Lineage for d3kr1a_ (3kr1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500976Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 2500998Protein automated matches [190168] (1 species)
    not a true protein
  7. 2500999Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries)
  8. 2501012Domain d3kr1a_: 3kr1 A: [179586]
    Other proteins in same PDB: d3kr1b2
    automated match to d1hnnb_
    complexed with sah, vgd

Details for d3kr1a_

PDB Entry: 3kr1 (more details), 2.3 Å

PDB Description: Crystal Structure of hPNMT in Complex AdoHcy and 5-chloro-1H-benzo[d]imidazol-2-amine
PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3kr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kr1a_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv

SCOPe Domain Coordinates for d3kr1a_:

Click to download the PDB-style file with coordinates for d3kr1a_.
(The format of our PDB-style files is described here.)

Timeline for d3kr1a_: