Lineage for d3kqsa_ (3kqs A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864792Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 1864814Protein automated matches [190168] (1 species)
    not a true protein
  7. 1864815Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)
  8. 1864816Domain d3kqsa_: 3kqs A: [179574]
    automated match to d1hnnb_
    complexed with ax7, sah

Details for d3kqsa_

PDB Entry: 3kqs (more details), 2 Å

PDB Description: crystal structure of hpnmt in complex adohcy and 2-aminobenzimidazole
PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3kqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kqsa_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv

SCOPe Domain Coordinates for d3kqsa_:

Click to download the PDB-style file with coordinates for d3kqsa_.
(The format of our PDB-style files is described here.)

Timeline for d3kqsa_: