Lineage for d1bvsc2 (1bvs C:64-134)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328799Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2328800Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 2328801Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 2328812Species Mycobacterium leprae [TaxId:1769] [47785] (1 PDB entry)
  8. 2328815Domain d1bvsc2: 1bvs C:64-134 [17957]
    Other proteins in same PDB: d1bvsa1, d1bvsa3, d1bvsb1, d1bvsb3, d1bvsc1, d1bvsc3, d1bvsd1, d1bvsd3, d1bvse1, d1bvse3, d1bvsf1, d1bvsf3, d1bvsg1, d1bvsg3, d1bvsh1, d1bvsh3
    protein/DNA complex

Details for d1bvsc2

PDB Entry: 1bvs (more details), 3 Å

PDB Description: ruva complexed to a holliday junction.
PDB Compounds: (C:) protein (holliday junction DNA helicase ruva)

SCOPe Domain Sequences for d1bvsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvsc2 a.60.2.1 (C:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]}
daenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrgaeri
vleladkvgpv

SCOPe Domain Coordinates for d1bvsc2:

Click to download the PDB-style file with coordinates for d1bvsc2.
(The format of our PDB-style files is described here.)

Timeline for d1bvsc2: