SCOPe 2.08: Domain d3kqia1: 3kqi A:1-69

Lineage for d3kqia1 (3kqi A:1-69)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein automated matches [190654] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)

8. Domain d3kqia1: 3kqi A:1-69 [179559]
   Other proteins in same PDB: d3kqia2
   automated match to d1wepa_
   complexed with cl, gol, mg, zn

Details for d3kqia1

PDB Entry: 3kqi, 1.78 Å

PDB Description: crystal structure of phf2 phd domain complexed with h3k4me3 peptide

PDB Compounds: (A:) PHD finger protein 2

SCOPe Domain Sequences for d3kqia1:

Sequence; same for both SEQRES and ATOM records:

>d3kqia1 g.50.1.2 (A:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matvpvycvcrlpydvtrfmiecdackdwfhgscvgveeeeapdidiyhcpncekthgks
tlkkkrtwh

Timeline for d3kqia1:

• d3kqia1 first appeared in SCOPe 2.01, called d3kqia_
  
• d3kqia1 appears in SCOPe 2.07