Lineage for d3kqad_ (3kqa D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2199729Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2199739Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2199871Protein automated matches [190917] (9 species)
    not a true protein
  7. 2199875Species Enterobacter cloacae [TaxId:550] [189691] (1 PDB entry)
  8. 2199879Domain d3kqad_: 3kqa D: [179549]
    automated match to d1dlga_
    complexed with ca, tr9

Details for d3kqad_

PDB Entry: 3kqa (more details), 2.25 Å

PDB Description: MurA dead-end complex with terreic acid
PDB Compounds: (D:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3kqad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kqad_ d.68.2.2 (D:) automated matches {Enterobacter cloacae [TaxId: 550]}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOPe Domain Coordinates for d3kqad_:

Click to download the PDB-style file with coordinates for d3kqad_.
(The format of our PDB-style files is described here.)

Timeline for d3kqad_: