SCOPe 2.01: Domain d3kpvb_: 3kpv B:

Lineage for d3kpvb_ (3kpv B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)

6. Protein automated matches [190168] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186895] (30 PDB entries)

8. Domain d3kpvb_: 3kpv B: [179540]
   automated match to d1hnnb_
   complexed with ade, sah

Details for d3kpvb_

PDB Entry: 3kpv, 2.4 Å

PDB Description: crystal structure of hpnmt in complex adohcy and adenine

PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3kpvb_:

Sequence; same for both SEQRES and ATOM records:

>d3kpvb_ c.66.1.15 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkvg

Timeline for d3kpvb_:

• d3kpvb_ is new in SCOPe 2.01-stable
  
• d3kpvb_ appears in SCOPe 2.02
  
• d3kpvb_ appears in the current release, SCOPe 2.08, called d3kpvb1