Lineage for d1bdxd2 (1bdx D:65-142)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4291Superfamily a.60.2: RuvA domain 2-like [47781] (2 families) (S)
  5. 4292Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 4293Protein DNA helicase RuvA subunit, middle domain [47783] (2 species)
  7. 4294Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 4303Domain d1bdxd2: 1bdx D:65-142 [17954]
    Other proteins in same PDB: d1bdxa1, d1bdxa3, d1bdxb1, d1bdxb3, d1bdxc1, d1bdxc3, d1bdxd1, d1bdxd3

Details for d1bdxd2

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (D:) holliday junction DNA helicase ruva

SCOP Domain Sequences for d1bdxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxd2 a.60.2.1 (D:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftp

SCOP Domain Coordinates for d1bdxd2:

Click to download the PDB-style file with coordinates for d1bdxd2.
(The format of our PDB-style files is described here.)

Timeline for d1bdxd2: