Lineage for d1bdxc2 (1bdx C:65-142)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715663Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 2715664Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 2715665Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 2715673Domain d1bdxc2: 1bdx C:65-142 [17953]
    Other proteins in same PDB: d1bdxa1, d1bdxa3, d1bdxb1, d1bdxb3, d1bdxc1, d1bdxc3, d1bdxd1, d1bdxd3
    protein/DNA complex

Details for d1bdxc2

PDB Entry: 1bdx (more details)

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (C:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1bdxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxc2 a.60.2.1 (C:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftp

SCOPe Domain Coordinates for d1bdxc2:

Click to download the PDB-style file with coordinates for d1bdxc2.
(The format of our PDB-style files is described here.)

Timeline for d1bdxc2: