Lineage for d3kpdb_ (3kpd B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023693Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1023694Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1023814Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 1023815Protein automated matches [191100] (3 species)
    not a true protein
  7. 1023818Species Methanocaldococcus jannaschii [TaxId:2190] [189191] (3 PDB entries)
  8. 1023825Domain d3kpdb_: 3kpd B: [179521]
    automated match to d2ef7a1
    complexed with mta, sam

Details for d3kpdb_

PDB Entry: 3kpd (more details), 2.91 Å

PDB Description: Crystal Structure of the CBS domain pair of protein MJ0100 in complex with 5 -methylthioadenosine and S-adenosyl-L-methionine.
PDB Compounds: (B:) Uncharacterized protein MJ0100

SCOPe Domain Sequences for d3kpdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpdb_ d.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
tlvkdilskppitahsnisimeaakilikhninhlpivdehgklvgiitswdiakalaqn
kktieeimtrnvitahedepvdhvaikmskynisgvpvvddyrrvvgivtsedisrlfgg
k

SCOPe Domain Coordinates for d3kpdb_:

Click to download the PDB-style file with coordinates for d3kpdb_.
(The format of our PDB-style files is described here.)

Timeline for d3kpdb_: