![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
![]() | Protein automated matches [191100] (15 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [189191] (3 PDB entries) |
![]() | Domain d3kpbd_: 3kpb D: [179518] automated match to d2ef7a1 complexed with gol, sam |
PDB Entry: 3kpb (more details), 1.6 Å
SCOPe Domain Sequences for d3kpbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpbd_ d.37.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} tlvkdilskppitahsnisimeaakilikhninhlpivdehgklvgiitswdiakalaqn kktieeimtrnvitahedepvdhvaikmskynisgvpvvddyrrvvgivtsedisrlfg
Timeline for d3kpbd_: