![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.4: UFC1-like [143072] (2 proteins) |
![]() | Protein automated matches [190848] (1 species) not a true protein |
![]() | Species Leishmania major [TaxId:5664] [189162] (1 PDB entry) |
![]() | Domain d3kpac_: 3kpa C: [179514] automated match to d1ywza1 |
PDB Entry: 3kpa (more details), 2.2 Å
SCOPe Domain Sequences for d3kpac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpac_ d.20.1.4 (C:) automated matches {Leishmania major [TaxId: 5664]} svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl warnvpyfgishvlalglgpwlsievpamveegylkp
Timeline for d3kpac_: